SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036657 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036657
Domain Number 1 Region: 390-756
Classification Level Classification E-value
Superfamily ARM repeat 2.48e-37
Family Plakophilin 1 helical region 0.014
Further Details:      
 
Domain Number 2 Region: 78-298
Classification Level Classification E-value
Superfamily RNI-like 1.39e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036657   Gene: ENSPTRG00000021439   Transcript: ENSPTRT00000039676
Sequence length 766
Comment pep:known chromosome:CHIMP2.1.4:9:127900261:127943914:-1 gene:ENSPTRG00000021439 transcript:ENSPTRT00000039676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNA
ACNFEPHESFFSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKS
LQTLRSFSHTLVSLSLFGCTNIFYEEENPGGCEDEYLVNPTCQVLVKDFTFEGFSRLRFL
NLGRMIDWVPVESLLRPLNSLAALDLSGIQTSDAAFLTQWKDSLVSLVLYNMDLSDDHIR
VIVQLHKLRHLDISRDRLSSYYKFKLTREVLSLFVQKLGNLMSLDISGHMILENCSISKM
EEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGDKNEEQVLNAI
EAYTEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYDRNIQVTGSAALFY
LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVNE
LLLSILNPTRQDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKIC
DQVMEFSWSALWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAE
VKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPEAWGVCEPQREEVE
ERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYPDKYCPL
LIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR
Download sequence
Identical sequences A0A2J8UJP2 G3R9I9 H2QXZ8
ENSPTRP00000036657 9598.ENSPTRP00000036657 XP_001159922.1.37143 XP_001159968.1.37143 XP_003822385.1.60992 XP_003822386.1.60992 XP_004048749.1.27298 XP_004048750.1.27298 XP_008974139.1.60992 XP_009455707.1.37143 XP_016817294.1.37143 XP_018888719.1.27298 ENSPTRP00000036657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]