SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036665 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036665
Domain Number 1 Region: 428-781
Classification Level Classification E-value
Superfamily L domain-like 2.78e-53
Family SCOPe 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036665   Gene: ENSPTRG00000021443   Transcript: ENSPTRT00000039684
Sequence length 810
Comment pep:known chromosome:CHIMP2.1.4:9:128058580:128090317:1 gene:ENSPTRG00000021443 transcript:ENSPTRT00000039684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWV
TKDSCNDSFRGWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHW
FAKYFPYLVLLHTLIFLACSNFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEE
SDPKPAFSKMNGSMDKKSSTVSEDVEATVPMLQRTKSRIEQGIVDRSETGVLDKKEGEQA
KALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIICYTVYYVHNIKFDVDCTVDIE
SLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKKYSFESIREES
SYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL
TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTA
AKIEAPALAFLRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGL
RELKRLKVLRLKSNLSKLPQVVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIR
CDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNHIAYIPIQIGN
LTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFLPADIGLLQNLQNLAITANRI
ETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLK
RSGLVVEEDLFNTLPPEVKERLWRADKEQA
Download sequence
Identical sequences A0A024R892 A0A0D9RPP4 A0A2K6BN22 A0A2K6SHR4 B0CM90 F7E1A8 G1S7B2 G3RLF5 G7PRE5 H2PTL1 H2QY01 Q8IWT6
ENSPPYP00000022042 ENSNLEP00000021401 ENSNLEP00000024167 ENSP00000259324 ENSGGOP00000016600 ENSGGOP00000016600 9544.ENSMMUP00000023403 9598.ENSPTRP00000036665 9600.ENSPPYP00000022042 9606.ENSP00000259324 NP_001120716.1.87134 NP_001120716.1.92137 NP_001120717.1.87134 NP_001120717.1.92137 NP_001244505.1.72884 NP_062540.2.87134 NP_062540.2.92137 XP_001161421.1.37143 XP_001161463.1.37143 XP_002820326.1.23681 XP_002820327.1.23681 XP_002820328.1.23681 XP_003264266.1.23891 XP_003264267.1.23891 XP_003264268.1.23891 XP_003822391.1.60992 XP_003940074.1.74449 XP_004048751.1.27298 XP_005252152.1.92137 XP_005252153.1.92137 XP_005580759.1.63531 XP_005580760.1.63531 XP_005580761.1.63531 XP_005580762.1.63531 XP_006717249.1.92137 XP_008004202.1.81039 XP_008004203.1.81039 XP_008974145.1.60992 XP_009243198.1.23681 XP_009455716.1.37143 XP_010349061.1.74449 XP_011517165.1.92137 XP_011517166.1.92137 XP_011517167.1.92137 XP_011709866.1.29376 XP_011709867.1.29376 XP_011709868.1.29376 XP_011709869.1.29376 XP_012364297.1.23891 XP_014201790.1.60992 XP_014972100.1.72884 XP_016817297.1.37143 XP_018888721.1.27298 XP_018888722.1.27298 XP_018888723.1.27298 ENSPPYP00000022042 ENSMMUP00000023403 ENSP00000259324 ENSP00000361680 ENSP00000361682 ENSMMUP00000023403 6djb_A 6djb_B 6djb_C 6djb_D 6djb_E 6djb_F ENSPTRP00000036665 ENSPTRP00000036665 ENSNLEP00000021401 ENSPANP00000018860 gi|187829871|ref|NP_001120716.1| gi|187829877|ref|NP_001120717.1| gi|62241040|ref|NP_062540.2| ENSP00000259324 ENSP00000361680 ENSP00000361682 NYSGRC-62241040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]