SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036737 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036737
Domain Number 1 Region: 121-336
Classification Level Classification E-value
Superfamily GFP-like 4.92e-62
Family Domain G2 of nidogen-1 0.0018
Further Details:      
 
Domain Number 2 Region: 32-123
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-24
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 343-485
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.65e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 580-687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 482-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000493
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 6 Region: 2-39
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000481
Family I set domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036737   Gene: ENSPTRG00000021472   Transcript: ENSPTRT00000039763
Sequence length 790
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:129734373:129757797:1 gene:ENSPTRG00000021472 transcript:ENSPTRT00000039763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLQRDDAGQYQCLAENEMGVAKKAVILVLQSAPVFQVEPQDMTVRSGDDVALRCQATGEP
TPTIEWLQAGQPLRASRRLRTLPDGSLWLENVETGDAGTYDCVAHNLLGSATARAFLVVR
GEPQGSWGSMTGVINGRKFGVATLNTSVMQEAHSGVSSIHSSIRHVPANVGPLMRVLVVT
IAPIYWALARESGEALNGHSLTGGRFRQESHVEFATGELLTMTQVARGLDPDGLLLLDVV
VNGVVPESLADADLQVQDFEEHYVQTGPGQLFVGSTQRFFQGGLPSFLRCNHSIQYNAAR
GPQPQLVQHLRASAISSAFDPEAEALRFQLTTALQAEENEVGCPEGFELDSQGAFCVDRD
ECSGGPSPCSHACLNAPGRFSCTCPTGFALAWDDRNCRDVDECAWDAHLCREGQRCVNLL
GSYRCLPDCGPGFRVAADGAGCEDVDECLEGLDDCHYNQLCENTPGGHRCSCPRGYRMQG
PSLPCLDVNECLQLPKACAYQCHNLQGSYRCLCPPGQTLLRDGKACTSLERNGQNVTTVS
HRGPLLPWLRPWASIPGTSYHAWVSLRPGPMALSSVGRAWCPPGFIRQNGVCTDLDECRV
RNLCQHACRNTEGSYQCLCPAGYRLLPSGKNCQDINECEEESIECGPGQMCFNTRGSYQC
VDTPCPATYRQGPSPGTCFRRCSQDCGTGGPSTLQYRLLPLPLGVRAHHDVARLTAFSEA
GVPANRTELSMLEPDPRSPFALRPLRAGLGAVYTRRALTRAGLYRLTVRAAAPRHQSVFV
LLIAVSPYPY
Download sequence
Identical sequences ENSPTRP00000036737 ENSPTRP00000036737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]