SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036924 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036924
Domain Number 1 Region: 1872-2116
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.89e-53
Family Ankyrin repeat 0.0000000601
Further Details:      
 
Domain Number 2 Region: 452-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000485
Family EGF-type module 0.00045
Further Details:      
 
Domain Number 3 Region: 1170-1312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 4 Region: 971-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000439
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 408-532
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000518
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 754-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000108
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 856-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 8 Region: 629-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000487
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 528-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000921
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 10 Region: 791-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000012
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 295-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 13 Region: 141-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000645
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 14 Region: 1146-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000354
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 563-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000511
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 16 Region: 219-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 177-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 18 Region: 257-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.016
Further Details:      
 
Domain Number 19 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000722
Family EGF-type module 0.026
Further Details:      
 
Domain Number 20 Region: 1489-1522
Classification Level Classification E-value
Superfamily Notch domain 0.000000116
Family Notch domain 0.0052
Further Details:      
 
Domain Number 21 Region: 332-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000124
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 22 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family EGF-type module 0.014
Further Details:      
 
Domain Number 23 Region: 60-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family EGF-type module 0.018
Further Details:      
 
Domain Number 24 Region: 1529-1561
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0043
Further Details:      
 
Domain Number 25 Region: 1391-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.02
Further Details:      
 
Domain Number 26 Region: 1114-1146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000177
Family EGF-type module 0.02
Further Details:      
 
Domain Number 27 Region: 1448-1480
Classification Level Classification E-value
Superfamily Notch domain 0.00000196
Family Notch domain 0.00017
Further Details:      
 
Domain Number 28 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000401
Family EGF-type module 0.057
Further Details:      
 
Domain Number 29 Region: 1345-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000765
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000036924
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.004
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 832-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0225
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036924   Gene: ENSPTRG00000021561   Transcript: ENSPTRT00000039960
Sequence length 2555
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:136091975:136143384:-1 gene:ENSPTRG00000021561 transcript:ENSPTRT00000039960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP
NPCLSTPCKNAGTCHVVDRRGVADYACSCPLGFSGPLCLTPLDNACLTNPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVN
ECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT
HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP
GYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNG
AKCLDGHNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID
GYECACEPGYTGSMCNINIDECVGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNEC
NSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGDTCEVVLAPCAPSPCRN
GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYS
GRNCETDIDDCRPNPCHNGGSCTDGINTAFCECLPGFRGTFCEEDINECASDPCRNGANC
TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQ
YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGS
YCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD
LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGG
TCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI
PPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYY
GREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEI
DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVA
AAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAP
TPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK
PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSVPLNHLPGMPDTHLGIGHLNVVAKPEMAALGGGGRLAFETGPPRLSHLPVAS
GTSTVLGSNSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP
SLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPA
NIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQE
SPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQW
SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Download sequence
Identical sequences ENSPTRP00000036924 ENSPTRP00000036924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]