SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036945 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036945
Domain Number 1 Region: 572-727
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-36
Family MAM domain 0.001
Further Details:      
 
Domain Number 2 Region: 62-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.97e-33
Family MAM domain 0.006
Further Details:      
 
Domain Number 3 Region: 889-1037
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-27
Family MAM domain 0.0039
Further Details:      
 
Domain Number 4 Region: 730-887
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-26
Family MAM domain 0.001
Further Details:      
 
Domain Number 5 Region: 269-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-18
Family MAM domain 0.014
Further Details:      
 
Domain Number 6 Region: 224-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 488-571
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000104
Family MAM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000036945
Domain Number - Region: 455-494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000327
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number - Region: 28-50
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0303
Family LDL receptor-like module 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036945   Gene: ENSPTRG00000021576   Transcript: ENSPTRT00000039983
Sequence length 1135
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:136248901:136447580:1 gene:ENSPTRG00000021576 transcript:ENSPTRT00000039983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTSSHVLPAVNLPAAGSSGWAWVPNHCRSPGQAVCNFVCDCRDCSDEAQCGYHGASPTLG
APFACDFEQDPCGWQDISTSGYSWLRDRAGAALEGPGPHSDHTLGTDLGWYMAVGTHRGK
EASTAALRSPTLREAASSCKLRLWYHAASGDVAELRVELIHGAETLTLWQSTGPWGPGWQ
ELAVTTGRIRGDFRVTFSATRNATHRGAVALDDLEFWDCGLPTPQANCPLGHHHCQNKVC
VEPQQLCDGEDNCGDLSDENPLTCGRHIATDFETGLGPWNRSEGWSWNHRAGGPERPSWP
RRDHSRNSAQGSFLVSVAEPGTPAILSSPEFQASGTSNCSLVFYQYLRGSEAGCLQLFLQ
TLGPSTPRAPVLLRRRRGELGTAWVRDRVDIQSAHPFQILLAGQTGPGGVVGLDDLILSD
HCRPVSEVSTLQPLPPGPRAPAPQPLPPSSRLQDSCKQGHLACGDLCVPPEQLCDFEEQC
AGGEDEQACGTTDFESPEAGGWEDASVGRLQWRRVSAQESQGSSAAAAGHFLSLQRAWGQ
LGAEARVLTPLLGPSGPSCELHLAYYLQSQPREVSCNFERDTCSWYPGHLSDTHWRWVES
RGPDHDHTTGQGHFVLLDPTDPLAWGHSAHLLSRPQVPAAPMECLSFWYHLHGPQIGTLR
LAMRREGEETHLWSRSGTQGNRWHEAWATLSHQPGSHAQYQLLFEGLRDGYHGTMALDDV
AVRPGPCWAPNYCSFEDSDCGFSPGGQGLWRRQANASGHAAWGPPTDHTTETAQGHYMVV
DTSPDALPRGQTASLTSKEHRPLAQPACLTFWYHGSLRSPGTLRVYLEERGKHQVLSLSA
HGGLAWRLGSVDVQAERAWRVVFEAVAAGVAHSYVALDDLLLQDGPCPQPGSCDFESGLC
GWSHLAWPGLGGYSWDWGGGATPSRYPQPPVDHTLGTEAGHFAFFETGVLGPGGRAAWLR
SEPLPATPASCLRFWYHMGFPEHFYKGELKVLLHSAQGQLAVWGAGGHRRHQWLEAQVEV
ARTKEFQIVFEATMGGQPALGPNKRWMTGVSGQRAHMSLWPTGNTAAPGYLPAVVGSALL
LLMLLVLLGLGGRRWLQKRGSCPFQSNTEATAPGFDNILFNADGVTLPASVTSDP
Download sequence
Identical sequences ENSPTRP00000036945 ENSPTRP00000036945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]