SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036986 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036986
Domain Number 1 Region: 44-233
Classification Level Classification E-value
Superfamily L domain-like 4.08e-36
Family Ngr ectodomain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036986   Gene: ENSPTRG00000021595   Transcript: ENSPTRT00000040026
Sequence length 338
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:136766945:136768227:-1 gene:ENSPTRG00000021595 transcript:ENSPTRT00000040026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLSWSRPRPLLLLLLLLLLSPWPVWAQVSATASPSGSPGAPDCPEVCTCVPGGLASCS
ALSLPAVPAGLSLRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGL
GALQLLDLSANQLEALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNE
LAALAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCVWPGRLT
LSPLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASCLALGSGLTACRARRRRLR
LRTAALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQA
Download sequence
Identical sequences H2QY81
ENSPTRP00000036986 ENSPTRP00000036986 9598.ENSPTRP00000036986 XP_520644.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]