SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037102 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037102
Domain Number 1 Region: 477-657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-50
Family SPRY domain 0.00074
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000103
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 371-482
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000138
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 165-226
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000839
Family B-box zinc-binding domain 0.000058
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000037102
Domain Number - Region: 108-161
Classification Level Classification E-value
Superfamily RING/U-box 0.000636
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037102   Gene: ENSPTRG00000021656   Transcript: ENSPTRT00000040155
Sequence length 666
Comment pep:known chromosome:CHIMP2.1.4:X:10364842:10488206:-1 gene:ENSPTRG00000021656 transcript:ENSPTRT00000040155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQAALSERYDKLKQNLESNLTNLIKRNTELETLL
AKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIAN
CKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFDT
FALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTIF
TGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLKT
NSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGRH
YWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPHL
RRVGILLDYDNGSIAFYDALNSIHLYTFDVAFAQPVCPTFTVWNKCLTIITGLPIPDHLD
CTEQLP
Download sequence
Identical sequences ENSPTRP00000037102 ENSPTRP00000037102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]