SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037386 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037386
Domain Number 1 Region: 114-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 222-275
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000139
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 77-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000584
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037386   Gene: ENSPTRG00000021796   Transcript: ENSPTRT00000040461
Sequence length 420
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:38495118:38568275:-1 gene:ENSPTRG00000021796 transcript:ENSPTRT00000040461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPI
KVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRC
PTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPP
RIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTRCGLNAPENGYMKCSSDGDNYGA
TCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLI
VSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLR
LLLRIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT
Download sequence
Identical sequences 9598.ENSPTRP00000037386 ENSPTRP00000037386 ENSPTRP00000037386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]