SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037540 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037540
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-35
Family Canonical RBD 0.000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037540   Gene: ENSPTRG00000021864   Transcript: ENSPTRT00000040626
Sequence length 157
Comment pep:known chromosome:CHIMP2.1.4:X:48943042:48947010:1 gene:ENSPTRG00000021864 transcript:ENSPTRT00000040626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHA
SVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDS
RPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Download sequence
Identical sequences A0A024QYX3 A0A0D9RLC1 A0A2I3MGL6 A0A2K5JJ18 A0A2K5WBE5 A0A2K6A584 A0A2K6DQM1 A0A2K6MCK6 A0A2K6PYX6 G3QST9 H2PVJ0 H2QYJ9 H9FY14 P98179
gi|5803137|ref|NP_006734.1| ENSP00000365946 ENSP00000365950 ENSP00000470199 ENSP00000471507 NP_001244635.1.72884 NP_006734.1.87134 NP_006734.1.92137 XP_003807263.1.60992 XP_007989785.1.81039 XP_007989786.1.81039 XP_010359400.1.97406 XP_010359401.1.97406 XP_011760159.1.29376 XP_011760160.1.29376 XP_011802107.1.43180 XP_011846808.1.47321 XP_014982801.1.72884 XP_015298762.1.63531 XP_015298763.1.63531 XP_017710650.1.44346 XP_017710651.1.44346 XP_018874707.1.27298 XP_521047.2.37143 ENSPTRP00000037540 ENSPPYP00000022739 ENSPPYP00000022738 9598.ENSPTRP00000037540 9600.ENSPPYP00000022739 9606.ENSP00000365946 ENSPTRP00000037540 ENSP00000365946 ENSP00000365950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]