SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038032 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038032
Domain Number 1 Region: 382-648
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-77
Family Protein kinases, catalytic subunit 0.000000000278
Further Details:      
 
Domain Number 2 Region: 4-168
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-53
Family Pleckstrin-homology domain (PH domain) 0.0000000302
Further Details:      
 
Domain Number 3 Region: 251-378
Classification Level Classification E-value
Superfamily SH2 domain 3.42e-33
Family SH2 domain 0.000041
Further Details:      
 
Domain Number 4 Region: 206-274
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-19
Family SH3-domain 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038032   Gene: ENSPTRG00000022104   Transcript: ENSPTRT00000041171
Sequence length 659
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:101693976:101737161:-1 gene:ENSPTRG00000022104 transcript:ENSPTRT00000041171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKANERPTFKILLSNILDVMDEES
Download sequence
Identical sequences ENSPTRP00000038032 9598.ENSPTRP00000038032 ENSPTRP00000038032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]