SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038049 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038049
Domain Number 1 Region: 375-558
Classification Level Classification E-value
Superfamily NTF2-like 6.86e-65
Family NTF2-like 0.000000941
Further Details:      
 
Domain Number 2 Region: 111-205
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.43e-37
Family Non-canonical RBD domain 0.0000643
Further Details:      
 
Domain Number 3 Region: 209-362
Classification Level Classification E-value
Superfamily L domain-like 6.12e-32
Family mRNA export factor tap 0.00000287
Further Details:      
 
Domain Number 4 Region: 556-622
Classification Level Classification E-value
Superfamily UBA-like 1.73e-24
Family TAP-C domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038049   Gene: ENSPTRG00000022116   Transcript: ENSPTRT00000041189
Sequence length 626
Comment pep:novel chromosome:CHIMP2.1.4:X:102883778:102903399:-1 gene:ENSPTRG00000022116 transcript:ENSPTRT00000041189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRNCHYEHGGYERPPSHCQE
NDGSVEMRDVHKDQQLRHTPYSIRCQRRTNWHSEDEIRITTWRNRKPPERKMSQNTQDGY
TRNWFKVTIPYGIKYDKAWLMNSIQSHCSDPFTPVDFHYVQNRACFFVQDASAASALKDV
SYKICDDENQKICIFVNHSTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFD
PDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKI
LNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRE
LPAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEAC
FSLAVPFDPKDSVPNSLCKYFKDSRNMKTLKNPYLKGELLRRTKRDIVDSLSALPKTQHD
LSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDELF
VRDASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWN
YTRAGQAFTMLQTEGKIPAEAFKQIS
Download sequence
Identical sequences 9598.ENSPTRP00000038049 ENSPTRP00000038049 ENSPTRP00000038049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]