SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038186 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038186
Domain Number 1 Region: 113-180
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000607
Family VWC domain 0.039
Further Details:      
 
Domain Number 2 Region: 35-101
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000018
Family VWC domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038186   Gene: ENSPTRG00000022186   Transcript: ENSPTRT00000041340
Sequence length 388
Comment pep:known_by_projection chromosome:CHIMP2.1.4:X:111106542:111231303:-1 gene:ENSPTRG00000022186 transcript:ENSPTRT00000041340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKKWKMGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLV
YCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPDSLPPVNNKVTSKSCEYNGT
TYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRG
DGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQQ
ASGTIVQIVINNKHKHGQVFILPGQSFDNKGYFCGEETMPVYESVFMEDGETTRKIALET
ERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQISQ
MCSSRVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences ENSPTRP00000038186 ENSPTRP00000038186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]