SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038838 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038838
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily Immunoglobulin 6.55e-17
Family V set domains (antibody variable domain-like) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038838   Gene: ENSPTRG00000022952   Transcript: ENSPTRT00000046929
Sequence length 285
Comment pep:known chromosome:CHIMP2.1.4:17:73371715:73383041:1 gene:ENSPTRG00000022952 transcript:ENSPTRT00000046929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFAPSDRRTVAGPVGGSLRVQCRYEEAHRTLNKYWCRPPQIFLCDKIVETKGSARKRNGR
VSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPA
SITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEENEEVVNSQLPLLLSLLALLLLLLV
GASLLAWRMFQKWIKAGDHSELSQNPKQAAKQSELHYANLELLMRPLQEKPAPPREVEVE
YSTVASPREELHYASVVFDSNTNRIAAQRPREEEQDSDYSVIRKT
Download sequence
Identical sequences 9598.ENSPTRP00000038838 ENSPTRP00000038838 ENSPTRP00000038838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]