SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038891 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038891
Domain Number 1 Region: 250-317
Classification Level Classification E-value
Superfamily XPC-binding domain 3.14e-24
Family XPC-binding domain 0.0000183
Further Details:      
 
Domain Number 2 Region: 1-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.83e-16
Family Ubiquitin-related 0.0000369
Further Details:      
 
Domain Number 3 Region: 152-208
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000511
Family UBA domain 0.00064
Further Details:      
 
Domain Number 4 Region: 334-385
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000159
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038891   Gene: ENSPTRG00000021229   Transcript: ENSPTRT00000048320
Sequence length 387
Comment pep:known chromosome:CHIMP2.1.4:9:106175074:106218357:1 gene:ENSPTRG00000021229 transcript:ENSPTRT00000048320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVST
PAPATTQQSAPASTTAVTCSTTTTVAQAPIPVPALAPTSTPASITPASATASSEPAPASA
AKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGY
EREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATT
TATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQE
HFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGL
VIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences ENSPTRP00000038891 ENSPTRP00000038891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]