SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000039348 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000039348
Domain Number 1 Region: 406-670
Classification Level Classification E-value
Superfamily RNI-like 8.48e-42
Family 28-residue LRR 0.038
Further Details:      
 
Domain Number 2 Region: 313-378
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000667
Family F-box domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000039348   Gene: ENSPTRG00000017116   Transcript: ENSPTRT00000047746
Sequence length 701
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:108273949:108798091:-1 gene:ENSPTRG00000017116 transcript:ENSPTRT00000047746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHVLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRTPAKVPPQPAAPRSRDCFFRGPCM
LCFIVHSPGAPAPAGPEEEPPLSPPPRDGAYAAASSSQHLARRYAALAAEDCAAAARRFL
LSSAAAAAAAAASASSPASCCKELGLAAAAAWEQQGRSLFLASLGPVRFLGPPAAVQLFR
GPTPSPAEPPTPPEMVCKRKGAGVPACTPCKQPRCGGGGCGGGGGGGGGGGPAGGGASPP
RPPDAGCCQAPEQPPQPLCPPPSSPTSEGAPTEAGGDAVRAGGTAPSSAQQQHECGDADC
REPPENPCDCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQ
FWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAY
RCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDE
GMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLR
NLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLV
SCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVT
VEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS
Download sequence
Identical sequences ENSPTRP00000039348 ENSPTRP00000039348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]