SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000039368 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000039368
Domain Number 1 Region: 426-615
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-32
Family Kelch motif 0.0089
Further Details:      
 
Domain Number 2 Region: 707-876
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 90-211
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 299-400
Classification Level Classification E-value
Superfamily Kelch motif 5.36e-17
Family Kelch motif 0.021
Further Details:      
 
Domain Number 5 Region: 1013-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000039368
Domain Number - Region: 60-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0265
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000039368   Gene: ENSPTRG00000002965   Transcript: ENSPTRT00000044603
Sequence length 1378
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:114521952:115376572:1 gene:ENSPTRG00000002965 transcript:ENSPTRT00000044603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGGRARTGTPQPAARGLWRARPAGGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQS
KPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPNYKYKTKCTW
LIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVV
TTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSVSVPSQVYCECDKYWKG
EACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSP
SVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTPSRGPLQRYGHSLA
LYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMEL
DSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSI
YVHGGYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTH
NDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSS
VLLNDILVYKPPNCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNILRAKCPPKTA
ASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSMSVKNYTKCHVRNEQICNKLTS
CKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRVNSSRENYDNAKLYCYNLSG
NLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEP
NDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTS
NGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWC
NDPSNTGRGHCIEGSSRGPMKLIGMHHNEMVLDTNLCPKEKNYEWSFIQCPACQCNGHST
CINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHLHTGKCFCTTK
GIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSN
KNLDISINASNNFNLNITWSVGSTAGTISGEETPIVSKNNIKEYRDSFSYEKFNFRSNPN
ITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWAS
RRREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVLT
VFLCLPRGSSGAPPPGQSGLAIASALIDISQQKASDSKDKTSGVRNRKHLSTRQGTCV
Download sequence
Identical sequences ENSPTRP00000039368 ENSPTRP00000039368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]