SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000039675 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000039675
Domain Number 1 Region: 525-558,640-714
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000039675   Gene: ENSPTRG00000022537   Transcript: ENSPTRT00000047520
Sequence length 762
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:109254798:109292526:-1 gene:ENSPTRG00000022537 transcript:ENSPTRT00000047520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSTNAFEENHKKTERHHKTFLDHLKVCCSCSPQKAKRIVLSLFPI
ASWLPAYRLKEWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAIIYLFLG
TSKHISVGPFPILSMMVGLAVSGAVSKAVPDRNATTLGLSNNSNNSSLLDDKRVTVAASV
TVLSGIIQLAFGILRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFIFQLTVPSHNDPLS
IFKVLVSVFSQIEKTNIADLVTALIVLLVVSIVKEINQRFKDKLPVPIPIEFIMTVIAAG
VSYGCDFKNRFKVAVVGDMNPGFQPPITPDVQAFQNTIGDCFGIAMVAFAVAFSVASVYS
LKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAIIVL
IVLLAIGFLLAPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLIWIMTFIFTIVL
GLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPS
PIYFANIGFFRQKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIK
DSDEELDNNQIEVLDQPINTTDLPFQIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVS
SMRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKNSIFFLTIHDAVLHILM
KKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF
Download sequence
Identical sequences H2QZW4
ENSPTRP00000039675 ENSPTRP00000039675 9598.ENSPTRP00000039675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]