SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000039710 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000039710
Domain Number 1 Region: 293-351
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000129
Family BSTI 0.098
Further Details:      
 
Domain Number 2 Region: 599-662
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000018
Family ATI-like 0.014
Further Details:      
 
Domain Number 3 Region: 344-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000408
Family VWC domain 0.064
Further Details:      
 
Domain Number 4 Region: 1617-1693
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000115
Family VWC domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000039710
Domain Number - Region: 660-701
Classification Level Classification E-value
Superfamily FnI-like domain 0.000272
Family VWC domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000039710   Gene: ENSPTRG00000023446   Transcript: ENSPTRT00000006019
Sequence length 1876
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:1146569:1180015:1 gene:ENSPTRG00000023446 transcript:ENSPTRT00000006019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGDFHYKTFDGDVFRFPGLCD
YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAMVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPRNLV
YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLTDKKKNVVVFKSDGSVLLNELQVNLPHVTA
SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESVCRDGRLHCRQIRLIGQSCT
APKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKEC
PCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDG
HCSYVAVQCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEEICKSKILN
QTQDGAFCYWEICGPNGTVEKHFNICSITTPPSTLTTFTTITLPTTPTTFTTTTTTTTPT
SSTVLSTTPTPRPTGTQSAPLRGSTTTSTVTPTPTPTSTQTPTSTPITTTTTVTPTPTPT
GTQSTTPTPVTTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPITTTS
TVTPTPTPTGTQSTTPTPITTTSTVTPTPTPTGTQSTTLTPITTTSTVTPTPTPTGTQST
TPTHITTTSTVTPTPTPTGTQSTTATPITTTTMVTQTPTPTSTQTPTTAPITTTTTVTPT
PTPTGTQTPTPTVITATTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTTGSTGPPTRT
STAPTAELTTSKPPPESSTPQTSRSTSSPLMESTTLLSTLSPAIETTSTAPPSTPTAPTT
TRGGHTLSPPPSTTTSPPLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNW
SCPSTPSPTPTPSKSTPTPSKPSPTPSKPTPSTKPPECPDFDPPRQENETWWLCDCFMAT
CKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCILPSGEIISNCEAAA
DQWLVKDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALV
PPQHYYDACVFDSCFMPGSSLECASLQAYAALCAQQNVCLDWRNHTHGACLVECPSHREY
QACGPAEEPTCKSCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCV
EDGTYLATEVNPADTCCNITVCKCNTSLCKEKPPVCPLGFEVKSKMVPGRCCPFYWCESK
GVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACSHVPCNTSCSPGFELMEAP
GECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPN
FDASICIPGSITLMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSGSCG
TFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPT
GTSHRSRRSPRHLGSG
Download sequence
Identical sequences ENSPTRP00000039710 ENSPTRP00000039710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]