SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000039926 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000039926
Domain Number 1 Region: 2042-2342
Classification Level Classification E-value
Superfamily BEACH domain 5.89e-124
Family BEACH domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 2460-2719
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-29
Family WD40-repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 1915-2001
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-20
Family PreBEACH PH-like domain 0.0059
Further Details:      
 
Domain Number 4 Region: 580-730
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000528
Family Laminin G-like module 0.062
Further Details:      
 
Domain Number 5 Region: 317-341,374-504
Classification Level Classification E-value
Superfamily ARM repeat 0.00000551
Family Clathrin heavy-chain linker domain 0.071
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000039926
Domain Number - Region: 1101-1167,1251-1291,1441-1626
Classification Level Classification E-value
Superfamily ARM repeat 0.0905
Family Armadillo repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000039926   Gene: ENSPTRG00000014864   Transcript: ENSPTRT00000044276
Sequence length 2751
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:47680250:47710270:1 gene:ENSPTRG00000014864 transcript:ENSPTRT00000044276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASERLYELWLLYYAQKDLGYLQQWLKAFVGAFKKSISLSSLEPRRPEEAGAEVPLLPL
DELHVLAEQLHQADLEQALLLLKLFIILCRNLENIEAGRGQVLVPRVLALLTKLVAELKG
CPPPQGQGTQLENVALHALLLCEGLFDPYQTWRRQRSGEVISSKEKSKYKFPPAALPQEF
SAFFQESLQNADHLPPVLLLRLIHLFCAVLAGGKENGQMAVSDGSVKGLLSVVRGWSRGP
APDPCLVPLALEALVGAVHVLHASRAPPRGPELRALLESYFHVLNADWPAGLSSGPEEAL
VTLRVSMLDAIPMMLACEDRPVLQATFLSNNCFEHLTRLIQNSKLYLQSRAPPEGDSDLA
TRLLTEPDVQKVLDQDTDAIAVHVVRVLTCIMSDSPSAKEVFKERIGYPHLQEVLQSHGP
PTHRLLQELLNMAVEGDHSMCPPPPIRNEQPVLVLAQWLPSLPTAELRLFLAQRLRWLCD
SCPASRATCVQAGLVGCLLDTLSTGLALEARCQEQLLALLQALGRVSIRPMELRHLLRPP
PGLDSEPGRAEAGKARHAGAVIRALSGMARHQGPARALRYFDLTPSMAGIMVPPVQRWPG
PGFTFHAWLCLHPMDTAPTPAPTRPLQRKQLYSFFTSSGSGFEAFFTAAGTLVVAVCTRK
EYLTMSLPEVSFADSAWHCVAIVHVPGRRPFSQNLVHVYKDGHLVKTAPLRCPSLSEPFS
SCCIGSAGYRTTTTTTGLPTPPVPATLAYTHPALTRSQSVPASTGLGWGSGLVAPLQEGS
IDSTLAGTQDTRWGSPTSLEGELGAVAIFHEALQATALRTLCTLGPNETAPFKPEGELHE
LSTRLLLHYSPQACKNNICLDLSPSHGLDGRLTGHRVETWDVKDVVNCVGGMGALLPLLE
RVAAQPKEAEAGPTETHDLVGPELTSGHNTQGLVLPLGKSSEERMERNAVAAFLLMLRNF
LQGHMVNQESLVQCQGPAIIGALLRKVPSWAMDMNVLMSAQLLMEQVAAEGSGPLLYLLY
QHLLFNFHLWTLSDFAVRLGHIQYMSSIVREHRQKLRKKYGVQFILDALRTHYSPQRERP
LAADDLRTVQTSLLGLAREFLVRSLSADDVQVTQTMLSFLAATGDDGQVVGALDLLLALL
HGSLAQESLAVFLLEPGNLEVLLALLVRPGSLPLLPDRVCKILRRLQQNERLPERSRQRL
RLRECGLQGLVACLPEGTVSPQLCQGLYKLFLGADCLNLSDLLAVVQLSLQADLSVRLDI
CRQLFHLIYGQPDVVRLLARQAGWQDVLTRLYVLEAATAGSPPPSSPESPTSPKPAPPKP
PTESPAEPSDVFLPSEAPCPDPDGFYHALSPFCTPFDLGLERSSVGSGNTAGGGGSSGTL
TPASQPGTPSPLDGPRPFPAASGRHSSSLSNVLEDGSLPEPTISGDDTSNTSNPQQTSEE
ELCNLLTNVLFSVTWRGVEGSDEAAWRERGQVFSVLTQLGASATLVRPPDCIKRSLLEMM
LESALTDIKEAPVGVLASLTQQALWLLRLLQDFLCAEGHGNQELWSEKLFEGVCSLLDRL
GAWPHLANGTADLREMAQIGLRLVLGYILLEDPQLHAQAYVRLHMLLQTAVPARREEACY
VLSKLEAALGRALNTSSSESATDEAGSPPAAAAAAERCSWLVPLVRTLLDRAYEPLGLQW
GLPSLPPTNGSPTFFEDFQAFCATPEWRHFIDKQVQPTMSQFEMDTYAKSHDLMSGFWNA
CYDMLMSSGQRRQRERAQSRRAFQELVLEPAQRRARLEGLRYTAVLKQQATQHSMALLHW
GALWRQLASPCGAWALRDTPTPRWKLSSAETYSRMRLKLVPNHHFDPHLEASALRDNLGE
VPLTPTEEASLPLAVTKEAKVSTPPEELQEDQLGEDELAELETPMEAAELDEQREKLVLS
AECQLVTVVAVVPGLLEVTTQNVYFYDGSTERVETEEGIGYDFRRPLAQLREVHLRRFNL
RRSALELFFIDQANYFLNFPCKVGTTPVSSPSQTPRPQPGPIPPHTQVRNQVYSWLLRLR
PPSQGYLSSRSPQEMLRASGLTQKWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVL
QDYVSPTLDLSNPAVFRDLSKPIGVVNPKHAQLVREKYESFEDPAGTIDKFHYGTHYSNA
AGVMHYLIRVEPFTSLHVQLQSGRFDCSDRQFHSVAAAWQARLESPADVKELIPEFFYFP
DFLENQNGFDLGCLQLTNEKVGDVVLPPWASSPEDFIQQHRQALESEYVSAHLHEWIDLI
FGYKQRGPAAEEALNVFYYCTYEGAVDLDHVTDERERKALEGIISNFGQTPCQLLKEPHP
TRLSAEEAAHRLARLDTNSPSIFQHLDELKAFFAEVVSDGVPLVLALVPHRQPHSFITQG
SPDLLVTVSASGLLGTHSWLPYDRNISNYFSFSKDPTMGSHKTQRLLSGPWVPGSGVSGQ
ALAVAPDGKLLFSGGHWDGSLRVTALPRGKLLSQLSRHLDVVTCLALDTCGIYLISGSRD
TTCMVWRLLHQGGLSVGLAPKPVQVLYGHGAAVSCVAISTELDMAVSGSEDGTVIIHTVR
RGQFVAALRPLGATFPGPIFHLALGSEGQIVVQSSAWERPGAQVTYSLHLYSVNGKLRAS
LPLAEQPTALTVTEDFVLLGTAQCALHILQLNTLLPAAPPLPMKVAIRSVAVTKERSHVL
VGLEDGKLIVVVAGQPSEVRSSQFARKLWRSSRRISQVSSGETEYNPAEAR
Download sequence
Identical sequences H2R007
ENSPTRP00000039926 XP_003309822.1.37143 ENSPTRP00000039926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]