SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040144 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040144
Domain Number 1 Region: 250-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000314
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 2 Region: 379-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 3 Region: 430-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 316-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000213
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 5 Region: 533-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000040144
Domain Number - Region: 480-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000142
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 832-914,949-1087
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000863
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 
Domain Number - Region: 94-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00176
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040144   Gene: ENSPTRG00000023820   Transcript: ENSPTRT00000047179
Sequence length 1170
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:188712533:188750361:-1 gene:ENSPTRG00000023820 transcript:ENSPTRT00000047179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPFFLLCFALPGLLHAQQACSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQYG
EWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVM
MEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRP
NARLNGGKVQLNLMDLASGIPATQSQKIQELGEITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGSCFCHGHADRCAPKPGASAGPSTAVQVHDVCVCQHNTAGPNCERCAPFYNNR
PWRPAEGQDAHECQRCDCNGHSETCHFDPAVFAASQGAYGGVCDNCRDHTEGKNCERCQL
HYFRNRRPGASIQETCIPCECDPDGAVPGPCDPVTGQCVCKEQVQGERCDLCKPGFTGLT
YANPQGCHRCDCNILGSRRDMPCDEESGRCLCLPNVVGPKCDQCAPYHWKLASGQGCEPC
ACDPHNSLSPQCNQFTGQCPCREGFGGLMCSAAAIRQCPNRTYGDAATGCRACDCDFRGT
EGPGCDKASGRCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALHLGR
LRNATASLWSGPGLEDRGLASRILDAKSKIEQIRAVLSSPAVTEQEVAQVASAILSLRRT
LQGLQLDLPLEEETSLPRDLESLDRSFNGLLTMYQRKREQFEKISSADPSGAFQMLSTAY
EQSAQAAQQVSDSSRLLDQLRDSRREAERLVRQAGGGGGTSSPKLVALRLEMSSLPDLTP
TFNKLCGNSRQMACTPISCPGELCPQDNGTACGSHCRGVLPRAGGAFLMAGQVAEQLRGF
NAQLQQTRQMIRAAEESASQIQSSAQRLETQVSASRSQMEEDVRRTRLLIQQVRDFLTDP
DTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARARRL
QAEAEEARSRAHAVEGQVEDVVGNLRQGTVALQEAQDTMQGTSRSLRLIQDRVAEVQQVL
RPAEKLVTSMTKQLGDFWTRMEELRRQARQQGAEAVQAQQLAEGASEQALSAQEGFERIK
QKYAELKDRFGQSSMLGEQGAQIQSVKTEAEELFAETMEMMDRMKDMELELLQGSQAIML
RSADLTGLEKRVEQIRDHINRRVLYYATCK
Download sequence
Identical sequences ENSPTRP00000040144 ENSPTRP00000040144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]