SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040300 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040300
Domain Number 1 Region: 291-585
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-77
Family Kelch motif 0.0000844
Further Details:      
 
Domain Number 2 Region: 8-62,117-181
Classification Level Classification E-value
Superfamily POZ domain 1.33e-28
Family BTB/POZ domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000040300
Domain Number - Region: 80-106
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040300   Gene: ENSPTRG00000023330   Transcript: ENSPTRT00000047755
Sequence length 597
Comment pep:known_by_projection chromosome:CHIMP2.1.4:18:28412821:28510548:-1 gene:ENSPTRG00000023330 transcript:ENSPTRT00000047755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPPLGGGVGGQDGLGAPKDQQQPPQQQPSQQQQPPPQEEPGTPSSSPDDKLLTSPR
AINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLNDQ
ISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELALFQ
MSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDKMRIRSNKKMLLLVGGLP
PGPDRLPSNLVQYYDDEKKTWKILTIMPYNSAHHCVVEVENFLFVLGGEDQWNPNGKHST
NFVSRYDPRFNSWIQLPPMQERRASFYACRLDKHLYVIGGRNETGYLSSVECYNLETNEW
RYVSSLPQPLAAHAGAVHNGKIYISGGVHNGEYVPWLYCYDPVMDVWARKQDMNTKRAIH
TLAVMNDRLYAIGGNHLKGFSHLDVMLVECYDPKGDQWNILQTPILEGRSGPGCAVLDDS
IYLVGGYSWSMGAYKSSTICYCPEKGTWTELEGDVAEPLAGPACVTVILPSCVPYNK
Download sequence
Identical sequences ENSPTRP00000040300 ENSPTRP00000040300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]