SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040353 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040353
Domain Number 1 Region: 294-482
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-51
Family SPRY domain 0.0000337
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-29
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 88-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.56e-18
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040353   Gene: ENSPTRG00000003257   Transcript: ENSPTRT00000042614
Sequence length 488
Comment pep:known chromosome:CHIMP2.1.4:11:5372087:5386668:1 gene:ENSPTRG00000003257 transcript:ENSPTRT00000042614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNSRESVIGQEGERSCPVCQ
TSYQPGNLRPNRHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCE
RSQEHRGHHTFLVEEVAREYQEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPER
CRIQTEFNQLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERR
CQGSAMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVFRELTDVQSYW
VDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVD
VAKKTAWILGVCSNSLGPTFSFNHYAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSP
SLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIP
MTLRRPSS
Download sequence
Identical sequences ENSPTRP00000040353 ENSPTRP00000040353 NP_001192105.1.37143 XP_008970676.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]