SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040468 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040468
Domain Number 1 Region: 518-713
Classification Level Classification E-value
Superfamily Fibronectin type III 4.51e-25
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 141-233
Classification Level Classification E-value
Superfamily Immunoglobulin 8.39e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 226-325
Classification Level Classification E-value
Superfamily Immunoglobulin 5.16e-20
Family I set domains 0.047
Further Details:      
 
Domain Number 4 Region: 28-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000906
Family V set domains (antibody variable domain-like) 0.059
Further Details:      
 
Domain Number 5 Region: 312-405
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000022
Family I set domains 0.062
Further Details:      
 
Domain Number 6 Region: 392-501
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000011
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040468   Gene: ENSPTRG00000023194   Transcript: ENSPTRT00000042972
Sequence length 1177
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:138083761:138282664:-1 gene:ENSPTRG00000023194 transcript:ENSPTRT00000042972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWCLGLAVLSLVISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRF
GFLLPIFIQFGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPED
DFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPRVTWKLRGKDLGQG
QGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNA
SQDVSLACHAEAYPTNLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYT
CVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKD
GKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAF
IERPKEEYFQEVGRELLIPCSAGDPPSVVSWTVGRGLQGQAQVDSNSSLILRPLTKEAHG
HWECSASNAVARVATSTNVYVLGTSPHVVTNVSVVALPKGANVSWEPGFDGGYLQRFSVW
YTPLAKRPDRMHHDWVSLAVPVGAAHLLVPGLQPHTQYQFSVLAQNKLGSGPFSEIVLSA
PEGLPTTPAAPRLPPTEIPPPLSPPRGLVAVRTPRGVLLHWDPPELVPKRLDGYVLEGRQ
GSQGWEVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTSGLEVYP
SRTQLPGLLPQPVLAGVVGGVCFLGVAVLVSILAACLMNRRRAARRRRKRLRQDPPLIFS
PTGKSAAPSALGSGSPDSVAKLKLQGSPVPSLRQSLLWGDPAGTPSPHPDPPSSRGPLPL
EPICRGPDGRFVMGPTVAAPQERSGREKAEPRTPAQRLARSFDCSSSSPSGAPQPLCIED
ISPVAPPPAAPPSPLPGPGPLLQYLSLPFFREMNVDGDWPPLEEPSPAAPPDYMDTRRCP
TSSFLRSPDTPPVSPRESLPGVVVGAGATAEPLFTALADWTLRERLLPGLLLAAPGGSLT
SQSSGRGSDSFVRPPSTAPCAGGSYFSPAPGDTSSWASGPERWPRREHVVTVSKRRNTSV
DENYEWDSEFPGDMELLETLHLGLASSRLRPEAEPELGVKTPEEGCLLNTAHVTGPEARC
AALREEFLAFRRRRDATRARLPAYRQPVPHPEQATLL
Download sequence
Identical sequences ENSPTRP00000040468 ENSPTRP00000040468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]