SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040859 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040859
Domain Number 1 Region: 36-160
Classification Level Classification E-value
Superfamily TIMP-like 1.8e-54
Family The laminin-binding domain of agrin 0.000000636
Further Details:      
 
Domain Number 2 Region: 1351-1558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-45
Family Laminin G-like module 0.00023
Further Details:      
 
Domain Number 3 Region: 1837-2042
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-39
Family Laminin G-like module 0.000000375
Further Details:      
 
Domain Number 4 Region: 1609-1812
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-33
Family Laminin G-like module 0.00053
Further Details:      
 
Domain Number 5 Region: 468-535
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.36e-17
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 6 Region: 901-970
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000101
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Domain Number 7 Region: 172-242
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000103
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 8 Region: 1147-1225
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000112
Family SEA domain 0.0031
Further Details:      
 
Domain Number 9 Region: 551-600
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000152
Family Ovomucoid domain III-like 0.0065
Further Details:      
 
Domain Number 10 Region: 618-665
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000236
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 11 Region: 699-750
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000114
Family Ovomucoid domain III-like 0.0044
Further Details:      
 
Domain Number 12 Region: 413-462
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000222
Family Ovomucoid domain III-like 0.0051
Further Details:      
 
Domain Number 13 Region: 793-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 14 Region: 341-389
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000025
Family Ovomucoid domain III-like 0.0098
Further Details:      
 
Domain Number 15 Region: 248-318
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000568
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 16 Region: 847-884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 17 Region: 1551-1586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000652
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040859   Gene: ENSPTRG00000022742   Transcript: ENSPTRT00000044736
Sequence length 2045
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:159467138:159501802:1 gene:ENSPTRG00000022742 transcript:ENSPTRT00000044736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPV
QHTYSCKVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPA
PPYLWPAHKNELMLNSSLMRITLRNLEAVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFG
AVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRG
PCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLR
RACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDD
GVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVT
CDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCA
VKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQC
RFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQMGLHVASAGPCE
TCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEAR
AGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSLVCGS
DGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITA
ARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDG
RSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPAT
CAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQ
ISIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPGALPLAPGSTARSQTTPPP
SSRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGG
GSGGLEPFEGSSVATPGPPVERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLEL
EGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSV
RAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGA
TSGAIAAVATARATTASRLPSSAVTPRALHPSHTSQSVAKTTAAPTTRRPPTTAPSRVPG
RRPPAPQQPPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAICEKVLGAPVPAFEGR
SFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGP
AVLTSAVPIEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPE
DQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHG
GAPCQNLEAGRFHCECPSGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGRE
GTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYN
GQKTDGKGDFVSLALQDRHLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRV
GDGPRVLGESPVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLT
PEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKS
AGDVDALAFDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYVA
LAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPL
GATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGQHPLHLLEDAVTKPELR
PCSTP
Download sequence
Identical sequences A0A2I3RFL0
ENSPTRP00000040859 ENSPTRP00000040859 XP_003319002.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]