SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041099 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041099
Domain Number 1 Region: 3-236
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000777
Family FAD-linked reductases, N-terminal domain 0.048
Further Details:      
 
Domain Number 2 Region: 234-274
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000322
Family L-aminoacid/polyamine oxidase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041099   Gene: ENSPTRG00000003095   Transcript: ENSPTRT00000044485
Sequence length 347
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:133199015:133210407:1 gene:ENSPTRG00000003095 transcript:ENSPTRT00000044485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRGNPVFQLAAEYGLLGEKELSEENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLF
YGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCV
SGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNG
SFQEAAFPGETFPVSVECEDGDRFLAHHVIVTVPLGFVGEHLDTFFDPPLPAEAEASVHV
LCGFIAGLESEFMETLSDEEVLLCLTQVLRRVTAPDPVCGGSHTSHVLLHDARGSAVGME
GGRPPPQSVGPAGAAAQAEALAGPSLLCSTRVGRLGPSFPLTDFSLA
Download sequence
Identical sequences ENSPTRP00000041099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]