SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041325 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041325
Domain Number 1 Region: 45-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-51
Family N-terminal domain of xrcc1 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041325   Gene: ENSPTRG00000023860   Transcript: ENSPTRT00000050791
Sequence length 206
Comment pep:novel chromosome:CHIMP2.1.4:11:69639406:69651871:-1 gene:ENSPTRG00000023860 transcript:ENSPTRT00000050791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFPGCSTCHLASVGLIFKSSSFLKPQNAFLCYGRRKSSSRGQKAKDPKYPVENLLNPDS
PRKPWLSCPQDKSGQLKVELQLERAVPIGYIDVGNCGCAFLQIDVGRSSWPLDRPFITLL
PATTLMSLTDSKQGKNRSGVRMFKDVDFLAPASGELWDRLRLTCSQPFTRHQSFGLAFLR
VRSSLDSLDDSVVGPSALVSSVLNKV
Download sequence
Identical sequences ENSPTRP00000041325 ENSPTRP00000041325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]