SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041363 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041363
Domain Number 1 Region: 3897-4059
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-32
Family SPRY domain 0.0011
Further Details:      
 
Domain Number 2 Region: 3701-3892
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-20
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 3 Region: 3505-3554
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000032
Family B-box zinc-binding domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000041363
Domain Number - Region: 3545-3660
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0434
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041363   Gene: ENSPTRG00000023686   Transcript: ENSPTRT00000046726
Sequence length 4066
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:35710882:35818757:-1 gene:ENSPTRG00000023686 transcript:ENSPTRT00000046726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRDSNHAGESFLGSDGDEEATRELETEEESEGEEDETAAESEEEPDSRLSDQDEEGKI
KQECIISDPSFSMVTVQREDSGITWETNSSRSSTPWASEESQTSGVCSREGSTVNSPPGN
VSFIVDEVKKVRKRTHKSKHGSPSLRRKGNRKRNSFESQDVPTNKKGSPLTSASQVLTTE
KEKSYTGIYDKARKKKTTSNTPPITGAIYKEHKPLVLRPVYIGTVQYKIKMFNSVKEELI
PLQFYGTLPKGYVIKEIHYRKGKDASISLEPDLDNSGSNTVSKTRKLVAQSIEDKVKEVF
PPWRGALSKGSESLTLMFSHEDQKKIYADSPLNATSALEHTVPSYSSSDRAEQGIQLRHS
QSVPQQPEDEAKPHEVEPPSVTPDTPATMFLRTTKEECELASPGTAASENDSSVSPSFAN
EVKKEDVYSAHHSISLEAVSPGLAASTQDGLDPDQEQPDLTSIERAEPVSAKLTPTHPSV
KGEKEENMLEPSISLSEPLMLEEPEKEEIETSLPIAITPEPEDSNLVEEEIIELDYPESP
LVSEKPFPPHMSREVEHKEEELILPLLAASSPEHVALSEEEREEIASVSTDSAFVSEYSV
PQDLNHELQEQEGEPVPPSNVEAIAEHAVLSEEENEEFEAYSPAAAPASERSLSPSTTEK
TSENQSPLFSTVTPEHMVLSGDEASESGCYTPDSTSASEYSVPSQATKQSLKQTIDHKSP
LISKGVSEYMIPSEEKEDTGSFTPAVAPASEPSLSPSTTEKTSECQSPLPSTATSEHVVP
SEGEDLGSERFTPDSKLISKYAAPLNATQESQKKIINEASQFKPKGISEHTVLSVDGKED
IGPSSPDLVVASEHSFPPHTTEMTSECQAPPLSATPSEYVVLSDEEAVELERYTPSSTSA
SEFSVPPYATPEAQEEEIVHRSLNLKGASSPMNLSEDDQEDIGPFSPDSAFVSEFSFPPY
ATQEAEKREFECDSPICLTSPSEHTILSDEDTEEAELFSPDSASQVSIPPFRISETEKNE
LEPDSLLTAVSASGYSCFSEADEEDIGSTAATPVSEQFSSSQKQKAETFPLMSPLEDLSL
PPSTDKSEKAEIKPEIPTTSTSVSEYLILAQKQKTQAYLEPESEDLIPSHLTSEVEKGER
EASSSVAAIPAALPAQSFIVKEETKPASPHSVLPDSVPAIKKEQEPTAALTLKAADEQMA
LSKVRKEEIVPDSQEATAHVSQDQKMEPQPTNVPESEMKYSVLPDVVDEPKKGVKPKLVL
NVTSELEQRKLSKNEPEVIKPYSPLKETSLSGPEVLSAVKMEMKHDSKITTTPIVLHSAS
SGVEKQVEHGPPALAFSALSEEIKKEIEPSSSTTTASVTKLDSNLTRAVKEEIPTDSSLV
TPVDRPVLIKVGKGELGSGLPPLVTSADEHSVLAEEDKVAIKGASPIETSSKHLAWSEAE
KEIKFDSLPSVSSIAEHSVLSEVEAKEVKAGLPVIKTSSSQHSDKSEEARVEDKQDLLFS
TVCDSERLVSSQKKSLMSTSEVLEPEHELSLSLWGEIKKKETELPSSQNVSPASKHIIPK
GKDEETASSSPELENLASGLAPTLLLLSDDKNKLAVEVSSTAQGDFPSEKQDVALAELFL
EPEKKDKPHQPLELPNAGSEFSSDLGRQSGSIGTKQAKSPITETEDSVLEKGPAELRSRE
GKEENRELYASSTMPAISELSSLLREESQNEEIKPFSPKIVSLESKEPPASVAEGGNPEE
FQPFTFSLKGLSEEVSHPADFKKGGNQEIGPLPPTGNLKAQVMGDILDKLSEETGHSNSS
QVLQSITEPSKIAPSDLLVEQKKTEKALHSDQTVKLPDVSTSFEDKQDLGIKQFSLMREN
LPLEQSKSFMTTKPVDVKETKMEEFFISPKDENWMLGKPENVASQHEQRIAGSVQLDSSG
SNELRPGQLKAAVSSKDHTCEVRKQVLPHSAEESHLSSQEAVSALDTSSGNVDTLSSKSY
SSEEVKLAEEPKSLVLAGNVERNIAEGKEIHSLMESESLLLEKANTELSWPSKEDSQEKI
KLPPERFFQKPVSGLSVEQVKSETISSSVKTAYFSAEGVLGNEKEAHRSTPPFPEEKPLE
ESKMVQSKVIDDADEGKKPAPEVKIPTQRKPISSIHAREPQSPESPEVTQKPPTQPKVAK
PDLPEEKGKKGISSFKSWMSSLFFGSSTPDNKVAEQEDLETQPSPSVEKAVTVIDPEGTI
PTNFNVAEKPADHSLSEVKLKTADEPRGTLVKSGDGQNVKEKSMILSNVEDLQQPKFISE
VSREDYGKKEISGDSEEMNINSVVTSADGENLEIQSYSLIGEKLVMEEAKTIVPPHVTDS
KRVQKPAIAPPSKWNISIFKKEPRSDQNQKSLLSFDVVDKVPQQPKSASSNFASKNITKE
SEKPESIILPVEESKGSLIDFSEDRLKKEMQNPTSLKISEEETKLRSVSPTEKKDNLENR
SYTLAEKKVLAEKQNSVAPLELRDSNEIGKTQITHGSRSTELKESKADAMPQHFYQNEDY
SERPKIIVGSEKEKGEEKENQVYVLSEGKKQQEHQPYSVNVAESMSRESDISLGHSLGET
QSFSLVKATSVTEKSEAMLAEAHPEIREAKAVGTQPHPLEESKVLVEKTKTFLPVTLSCR
DEIENHSLSQEGNLVLEKSSRDMPDHSEEKEQFRESELSKGGSVDITKEIVKQGFQEKAV
GTQPHPLEESKVLVEKTKTFLPVVLSCHDEIENHSLSQEGNLVLEKSSRDMPDHSEEKEQ
FKESELWKGGSVDITKESMKEGFPSKESERTLARPFDETKSSETPPYLLSPVKPQTLASG
ASPEINAVKKKEMPRSELTPERHTVHTIQTSKDDTSDVPKQSVLVSKHHLEAAEDTRVKE
PLSSAKSNYAQFISNTSASNADKMVSNKEMPKEPEDTYAKGEDFTVTSKPAGLSEDQKTA
FSIISEGCEILNIHAPAFISSIDQEESEQMQDKLEYLEEKASFKTIPLPDDSETVACHKT
LKSRLEDEKVTPLKENKQKETRKTKEEISTDSETDLSFIQPTIPSEEDYFEKYTLIDYNI
SPDPEKQKAPQKLNVEEKLSKEVTEETISFPVSSVESALEHEYDLVKLDESFYGPEKGHD
ILSHPETQSQNSADRNVSKDTKRYVDSKSPGMPLFEAEEGVLSRTQIFPTTIKVIDPEFL
EEPPALAFLYKDLYEEAVGEKKKEEETASEGDSVNSEASFPSRNSDTDDGTGIYFEKYIL
KDDILHDTSLTQKDQGQGLEEKRVGKDDSYQPIAAEGEIWGKFGTICREKSLEEQKGVYG
EGESVDHVETIGNVAMQKKAPITEDVRVATQKISYAVPFEDNHHVLERADEAGSQGNEVG
NASPEVNLNVPVQVSFPEEEFASGATHVQETSLEEPKILVPPEPSEERLRNSPVQDEYEF
TESLHNEVLPQDILSEELSSESTPEDVLSQGKESFEHISENEFASEAEQSTSAEQKELGS
ERKEEDQLSSEVVTEKAQKELKKSQIDTYCYTCKCPISATDKVFGTHKDHEVSTLDTAIS
AVKVQLAEFLENLQEKSLRIEAFVSEIESFFNTIEENCSKNEKRLEEQNEEMMKKVLAQY
DEKAQSFEEVKKKKMEFLHEQMVHFLQSMDTAKDTLETIVREAEELDEAVFLTSFEEINE
RLLSAMESTASLEKMPAAFSLFEHYDDSLARSDQMLKQVAVPQPPRLEPQEPNSATSTTI
AVYWSMNKEDVIDSFQVYCMEEPQDDQEVNELVEEYRLTVKESYCIFEDLEHDGCYQVWV
MAVNFTGCSLPSERAIFRTAPSTPVIRAEDCTVCWNTATIRWRPTTPEATETYTLEYCRQ
HSPEGEGLRSFSGIKGLQLKVNLQPNDNYFFYVRAINAFGTSEQSEAALISTRGTRFLLL
RETAHPALHISSSGTVISFGERRRLTEIPSVLGEELPSCGQHYWETTVTDCPAYRLGICS
SSAVQAGALGQGETSWYMHCSEPQRYTFFYSGIVSDVHVTERPARVGILLDYNNQRLIFI
NAESEQLLFIVRHRFNEGVHPAFALEKPGKCTLHLGIEPPDSVRHK
Download sequence
Identical sequences ENSPTRP00000041363 ENSPTRP00000041363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]