SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041364 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041364
Domain Number 1 Region: 24-226
Classification Level Classification E-value
Superfamily L domain-like 5.99e-40
Family Leucine rich effector protein YopM 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041364   Gene: ENSPTRG00000022651   Transcript: ENSPTRT00000048131
Sequence length 277
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:69400264:69401097:-1 gene:ENSPTRG00000022651 transcript:ENSPTRT00000048131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTIRALVAFIPADRCQNYVVRDLREMPLDKMVDLSGSQLRRFPLHVCSFRELVKLYLS
DNHLNSLPPELGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKLCDLPSELSLL
QNLRTLWIEANCLTQLPDVVCELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLT
DFPAVLLHMPFLEVIDVDWNSIRYFPSLAHLSSLKLVIYDHNPCRNAPKVAKGVRRVGRW
AEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS
Download sequence
Identical sequences G3SF95 H2R0W3
9598.ENSPTRP00000041364 ENSPTRP00000041364 ENSPTRP00000041364 ENSGGOP00000026779 XP_004053599.1.27298 XP_522465.1.37143 ENSGGOP00000026779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]