SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041384 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041384
Domain Number 1 Region: 528-706
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-45
Family SPRY domain 0.003
Further Details:      
 
Domain Number 2 Region: 185-250
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.63e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 21-108
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000122
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 4 Region: 395-443,485-533
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000248
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000041384
Domain Number - Region: 126-181
Classification Level Classification E-value
Superfamily RING/U-box 0.00283
Family ZZ domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041384   Gene: ENSPTRG00000023571   Transcript: ENSPTRT00000044160
Sequence length 735
Comment pep:known chromosome:CHIMP2.1.4:X:108246370:108353780:1 gene:ENSPTRG00000023571 transcript:ENSPTRT00000044160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESPASVVLNASGGLFSLKMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVS
SCSSGESIEPITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSES
RRERTYRPTTAMSSERIACQFCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHR
LVEPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLK
QTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMI
AVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVA
MATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTIT
VHWISDDEFSISSYELQYTIFTGQANFISKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGL
YNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDP
KMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSS
TWYAIGIAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDY
DNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNC
RPQESPYVSGMKTCH
Download sequence
Identical sequences H2R0X0 Q9UJV3
ENSP00000410730 NP_036348.2.87134 NP_036348.2.92137 XP_016798379.1.37143 XP_521213.3.37143 gi|223890257|ref|NP_036348.2| ENSP00000262843 9606.ENSP00000262843 ENSPTRP00000041384 ENSP00000262843 ENSPTRP00000041384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]