SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041560 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000041560
Domain Number - Region: 237-361
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00184
Family APC10-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041560   Gene: ENSPTRG00000024395   Transcript: ENSPTRT00000045231
Sequence length 379
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:29743863:29765027:-1 gene:ENSPTRG00000024395 transcript:ENSPTRT00000045231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNILLPVRNNDQAL
GLTQCVLGCVSWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSI
HLPSKMKVWQDDSINGPLQSLRLYQEKVRHHSGEIQDLRGSMNQLIAKLQEMEAMSDEQK
MAQKIMKMIHGDYIEKPDFALKSIGASIDFEHTSATYNHEKAHSYWNWIQLWNYAQPPDV
ILEPNVTPGNCWAFEGDRGQVTIQLAQKVYLSNLTLQHIPKTISLSGSLDTAPKDFVIYG
MEGSPKEEVFLGAFQFQPENIIQMFPLQNQPARAFGAVKVKISSNWGNPGFTCLYRVRVH
GSVAPPREQPHQNPYPERD
Download sequence
Identical sequences H2R106
ENSPTRP00000041560 9598.ENSPTRP00000041560 ENSPTRP00000041560 XP_525300.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]