SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041876 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041876
Domain Number 1 Region: 272-417
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.89e-32
Family AlaX-like 0.022
Further Details:      
 
Domain Number 2 Region: 47-172
Classification Level Classification E-value
Superfamily HSP20-like chaperones 3.35e-28
Family Co-chaperone p23-like 0.00011
Further Details:      
 
Domain Number 3 Region: 213-269
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000215
Family AlaX-M N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041876   Gene: ENSPTRG00000009230   Transcript: ENSPTRT00000043662
Sequence length 461
Comment pep:known chromosome:CHIMP2.1.4:17:14404703:14427357:1 gene:ENSPTRG00000009230 transcript:ENSPTRT00000043662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYV
FMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSSRSITCF
VRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPP
PAMDDLDFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDDRGTIND
ISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVADHLFKLK
TTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSGR
GLPDDHAGPIRVVSIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTNLIFLAGNRV
LKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQK
Download sequence
Identical sequences ENSPTRP00000041876 ENSPTRP00000041876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]