SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041947 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041947
Domain Number 1 Region: 209-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-31
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 422-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000518
Family Nucleotide and nucleoside kinases 0.029
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily SAP domain 0.0000000044
Family SAP domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041947   Gene: ENSPTRG00000011019   Transcript: ENSPTRT00000020476
Sequence length 856
Comment pep:known chromosome:CHIMP2.1.4:19:46429166:46472561:1 gene:ENSPTRG00000011019 transcript:ENSPTRT00000020476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHI
NEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQEN
ESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRG
RGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFA
YLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPF
SYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQK
EALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVL
IQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKD
RTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRK
AGPPPEKRFDNRGGGGFRGRGGGGGFQRYDNRGPPGGNRGGFQNRGGGSGGGGNYRGGFN
RSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA
RNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPP
PPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY
DYGSYSGNTQGGTSTQ
Download sequence
Identical sequences G2HE12
9598.ENSPTRP00000041947 ENSPTRP00000041947 ENSPTRP00000041947 NP_001233455.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]