SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042055 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042055
Domain Number 1 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-28
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 2 Region: 1906-2073
Classification Level Classification E-value
Superfamily Fibronectin type III 4.76e-26
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 1635-1799
Classification Level Classification E-value
Superfamily Fibronectin type III 6.84e-24
Family Fibronectin type III 0.0000113
Further Details:      
 
Domain Number 4 Region: 909-1079
Classification Level Classification E-value
Superfamily Fibronectin type III 2.12e-23
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 4.36e-23
Family Fibronectin type III 0.000007
Further Details:      
 
Domain Number 6 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 1.64e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.48e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 1811-1901
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-19
Family Fibronectin type III 0.00000341
Further Details:      
 
Domain Number 10 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 3.5e-17
Family Fibronectin type III 0.00000264
Further Details:      
 
Domain Number 11 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000864
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 12 Region: 2340-2383
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000183
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000317
Family Fibronectin type III 0.00000288
Further Details:      
 
Domain Number 14 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000327
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 15 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000118
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 16 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 18 Region: 2295-2338
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000523
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 19 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 20 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 21 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2383-2424
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000144
Family Fibronectin type I module 0.00034
Further Details:      
 
Domain Number 24 Region: 2209-2273
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000584
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 25 Region: 1092-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000221
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042055   Gene: ENSPTRG00000012892   Transcript: ENSPTRT00000043828
Sequence length 2477
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:220384219:220463506:-1 gene:ENSPTRG00000012892 transcript:ENSPTRT00000043828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGTGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKIQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHLSGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPSLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPRSPPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE
Download sequence
Identical sequences H2R1A9
ENSPTRP00000042055 XP_516072.3.37143 ENSPTRP00000042055 9598.ENSPTRP00000042055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]