SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042163 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000042163
Domain Number - Region: 63-211,667-679
Classification Level Classification E-value
Superfamily ARM repeat 0.00472
Family PBS lyase HEAT-like repeat 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042163   Gene: ENSPTRG00000022963   Transcript: ENSPTRT00000050973
Sequence length 1209
Comment pep:known chromosome:CHIMP2.1.4:12:32908213:32941363:1 gene:ENSPTRG00000022963 transcript:ENSPTRT00000050973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQI
LQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGNLPKEPSFRHHFLQVLTYLQAY
KEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKID
DDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLMFRDQNPEQLAGVGQG
RLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKG
LHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGS
VKDHLLREKAQQYDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYE
MMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRE
LFLALFRKFDERCQPRSFLRDLVETTHLFLKMLERFCRSRGNLVVQNKQKKRRKKKKKVL
DQAIVSGNVPSSPEEVEAVWPALAEQLQCCAQNSELSMDSVVPFDAASEVPVEEQRAEAM
VRIQDCLLAGQAPQALTLLRSAREVWPEGDVFGSQDIFPEEEIQLLKQILSAPLPRQQGP
EERGAEEEEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSA
HTNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFAKYILGKFFA
LAAVNQKAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLANKD
VEGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQR
LFEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKRRKKLASSILPNG
AESLKDFCQEDLEEEENLPEEDSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPL
LWLQNCLIRAADDREEDGCSQAVPLVPLTEENEEAMENEQFQQLLRKLGVRPPASGQETF
WRIPAKLSPTQLRRVAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLL
AHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKR
YQIEDDEDD
Download sequence
Identical sequences H2R1D2
9598.ENSPTRP00000042163 ENSPTRP00000042163 XP_509535.2.37143 ENSPTRP00000042163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]