SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042428 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042428
Domain Number 1 Region: 75-396
Classification Level Classification E-value
Superfamily L domain-like 3.06e-58
Family Leucine rich effector protein YopM 0.03
Further Details:      
 
Domain Number 2 Region: 489-629
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.78e-36
Family Gelsolin-like 0.00028
Further Details:      
 
Domain Number 3 Region: 1034-1142
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.09e-25
Family Gelsolin-like 0.00082
Further Details:      
 
Domain Number 4 Region: 609-714
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.57e-23
Family Gelsolin-like 0.00072
Further Details:      
 
Domain Number 5 Region: 778-822,857-942
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.57e-23
Family Gelsolin-like 0.013
Further Details:      
 
Domain Number 6 Region: 932-1024
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000351
Family Gelsolin-like 0.0015
Further Details:      
 
Domain Number 7 Region: 6-100
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000049
Family Polygalacturonase inhibiting protein PGIP 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042428   Gene: ENSPTRG00000008847   Transcript: ENSPTRT00000050457
Sequence length 1149
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:37661396:37675297:1 gene:ENSPTRG00000008847 transcript:ENSPTRT00000050457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATGVLPFVRGVDLSGNDFKGGYFDENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECP
RELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLV
LNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPE
CLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLN
SNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNYLVTLPEAIH
FLTEIEVLDVRENPNLVMPPKPADRAAEWYNIDFSLQNQLRLAGASPATVAAAAAAGSGP
KDPMARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGL
EKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGS
LNWEIYYWIGGEATLDKKACSAIHAVNWRNYLGAECRTVREEMGDESEEFLQVFDNDISY
IEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWR
GAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKNWDDV
LTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWN
EDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEEKAE
GKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPGKLEVVR
MTQQQENPKFLSHFKRKFIIHRGKRKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLL
NSEFCFILKVPFESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEP
ENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDN
GQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHA
WSAFCKALA
Download sequence
Identical sequences ENSPTRP00000042428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]