SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042708 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042708
Domain Number 1 Region: 179-225
Classification Level Classification E-value
Superfamily UBA-like 0.000000567
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042708   Gene: ENSPTRG00000014216   Transcript: ENSPTRT00000047340
Sequence length 249
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:27959485:28007769:-1 gene:ENSPTRG00000014216 transcript:ENSPTRT00000047340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRGALPQWLPPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAAGAFRWLEPSERWLQVLQ
EGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPP
PSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAP
WLSNSSVFSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGRP
AHSEGPGPP
Download sequence
Identical sequences ENSPTRP00000042708 ENSPTRP00000042708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]