SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042713 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042713
Domain Number 1 Region: 39-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 152-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000633
Family Pentraxin (pentaxin) 0.0049
Further Details:      
 
Domain Number 3 Region: 859-1139
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000412
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042713   Gene: ENSPTRG00000018663   Transcript: ENSPTRT00000049354
Sequence length 1249
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:143743372:143885626:1 gene:ENSPTRG00000018663 transcript:ENSPTRT00000049354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPNDY
PNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFN
SSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELS
AFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVKE
KEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIV
SLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYLI
PLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQNI
LRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWAL
LVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLSHCLAMEEPKGYYWPSIQP
SEYVLPCLDKPGFSASRTCFYNATNPLVTYWGPVDISNCLKEANEVANQILNLTADGQNL
TSANITNIVEQVKRIVNKEENIDITLGSTLMNIFSNILSSSDSDLLESSSEALKTIDELA
FKIDLNSTSHVNITTRNLALGVSSLLPGTNAISNFSIGLPSNNESYFQMDFESGQVDPLA
SVILPPNLLENLSQEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVMACSIGNITIQN
LKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHFT
HFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKIL
MNLSTALLFLNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALVK
VFNTYIRRYILKFCIIGWGLPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQDPVIF
YVTCAGYFGVMFFLNIAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMTW
GFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLADNSD
WSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTDNASMDKSLS
KLAHADGDQTSIIPVHQVIDKVKGYCNAHSDNFYKNIIMSDTFSHSTKF
Download sequence
Identical sequences A0A2I3T5K2
XP_016811886.1.37143 9598.ENSPTRP00000042713 ENSPTRP00000042713 ENSPTRP00000042713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]