SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042754 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042754
Domain Number 1 Region: 62-302
Classification Level Classification E-value
Superfamily L domain-like 5.19e-51
Family Ngr ectodomain-like 0.000000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042754   Gene: ENSPTRG00000022541   Transcript: ENSPTRT00000043244
Sequence length 303
Comment pep:known chromosome:CHIMP2.1.4:X:154202960:154205629:1 gene:ENSPTRG00000022541 transcript:ENSPTRT00000043244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYS
AMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALV
LVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFS
GLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNK
IQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
LLQ
Download sequence
Identical sequences 9598.ENSPTRP00000042754 ENSPTRP00000042754 ENSPTRP00000042754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]