SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042778 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042778
Domain Number 1 Region: 100-205
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000542
Further Details:      
 
Domain Number 2 Region: 491-596
Classification Level Classification E-value
Superfamily SRCR-like 1.12e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000471
Further Details:      
 
Domain Number 3 Region: 230-337
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000505
Further Details:      
 
Domain Number 4 Region: 990-1095
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000505
Further Details:      
 
Domain Number 5 Region: 1379-1482
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000514
Further Details:      
 
Domain Number 6 Region: 730-833
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000455
Further Details:      
 
Domain Number 7 Region: 1248-1352
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000455
Further Details:      
 
Domain Number 8 Region: 859-963
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000403
Further Details:      
 
Domain Number 9 Region: 360-464
Classification Level Classification E-value
Superfamily SRCR-like 6.67e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000403
Further Details:      
 
Domain Number 10 Region: 1119-1222
Classification Level Classification E-value
Superfamily SRCR-like 1.07e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000424
Further Details:      
 
Domain Number 11 Region: 599-703
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000424
Further Details:      
 
Domain Number 12 Region: 1625-1732
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 13 Region: 1507-1619
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 14 Region: 1749-1858
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-33
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042778   Gene: ENSPTRG00000022758   Transcript: ENSPTRT00000046026
Sequence length 2148
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:122046348:122117274:1 gene:ENSPTRG00000022758 transcript:ENSPTRT00000046026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISTVILEMCLLWGQVLSTGGWIPRATDYASLIPSEVPLDTTVAEGSPFPSELTLESTV
AEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYR
GSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWS
CPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGFESSLALRLVNGG
DRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDD
VRCSGHESYLWNCPHNGWLTHNCGHSEDAGVICSASQSWPTPSPDTWPTSRASTAGSESS
LALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQ
GSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPRPDTLPTIT
LPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWA
MSAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHGEDAGVICSGPESSL
ALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQG
SGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQSRSTPRPDTLSTITL
PPSTVGSESSLTLRLVNGSDRCQGRVEILYRGSWGTVCDDSWDTSDANVVCRQLGCGWAT
SAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPT
PSPYTWPTSRASTAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVC
RQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVI
CSAAHSWSTPRPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDD
YWDTNDANVVCRQLGCGWAMSAPGNARFGRGSGPIVLDDVRCSGHESYLWSCPHNGWLSH
NCGHSEDAGVICSASQSRLTPSPETWPTSRASTAGSESSLALRLVNGGDRCQGRVEVLYR
GSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWS
CPHNGWLSHNCGHHEDAGVICSVSQSRPTPSPDTWPTSRASTAGSESTLALRLVNGGDRC
RGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRC
SGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQSQSTPRPDTWLTTNLPAPPIGSESSL
ALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQG
SGPIVLDDVRCSGNESYLWSCPHNGWLTHNCGHHEDAGVICSVTQINSTTTDWWHPTTTT
TARPSSNCGGFLFYASGTLSSPSYPAYYPNNAKCVWEIEVNSGYRINLGFSNLKLEAHHN
CSFDYVEIFDGSLNSSLLLGKICNDTRQIFTSSYNRMTIHFRSDISFQNTGFLAWYNSFP
SDATLRLVNLNSSYGLCAGRVEIYHGGTWGTVCDDSWTIQEAEVVCRQLGCGRAVSALGN
AYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHREDAGVICSGNQLSTPAPFLN
ITRPNTDYSCGGFLSQPSGGFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGG
CNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFISDHSITRRGFRAEYYSSP
SNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNGYYECRPQITPNLVIFTIPYS
GCGTFKQADNDTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRMLQNTWVDTMYIANDTIQV
EEVQYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQDLYVQAEILHSDAVLTLFVDTCVAS
PYSNDFTSLTYDLIRSGCVRDDTYGPYSSPSLRIARFRFRAFHFLNRFPSVYLRCKMVVC
RAYDPSSRCYRGCVLRSKRDVGSYLEKVDVVLGPIQLQNPPRREEEPR
Download sequence
Identical sequences ENSPTRP00000042778 ENSPTRP00000042778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]