SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043320 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043320
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily L domain-like 5.78e-19
Family Internalin LRR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043320   Gene: ENSPTRG00000041964   Transcript: ENSPTRT00000047058
Sequence length 129
Comment pep:novel chromosome:CHIMP2.1.4:15:32059943:32060789:1 gene:ENSPTRG00000041964 transcript:ENSPTRT00000047058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMGRRIHLELRNRTPSDVKELVLGNSRSNEGKLEGLTDESELEFLSAINVGLTSIANLP
KLNLKKLKLSDNRVSGGVEALAEKCPNLTHLNLRGNKIKDLSTTEPLKNLEDLKSLDLFN
EETNMKVFR
Download sequence
Identical sequences ENSPTRP00000043320 ENSPTRP00000043320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]