SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043367 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043367
Domain Number 1 Region: 51-500
Classification Level Classification E-value
Superfamily Sema domain 3.01e-148
Family Sema domain 0.0000000128
Further Details:      
 
Domain Number 2 Region: 496-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000384
Family Plexin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000043367
Domain Number - Region: 559-638
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0365
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043367   Gene: ENSPTRG00000001448   Transcript: ENSPTRT00000042166
Sequence length 663
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:134447185:134469905:1 gene:ENSPTRG00000001448 transcript:ENSPTRT00000042166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKG
LQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPST
QVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLP
FNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSFLDIERVFKGKYKELNKE
TSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGA
VFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMER
GNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPLAGIPREHV
KVP
Download sequence
Identical sequences ENSPTRP00000043367 ENSPTRP00000043367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]