SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043516 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000043516
Domain Number - Region: 380-492,535-677
Classification Level Classification E-value
Superfamily ARM repeat 0.0599
Family GUN4-associated domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043516   Gene: ENSPTRG00000001188   Transcript: ENSPTRT00000048242
Sequence length 2346
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:113493724:113644139:1 gene:ENSPTRG00000001188 transcript:ENSPTRT00000048242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNGYRTLSQHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKR
ELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRLAK
NEAARMAALVEAEKECNLELSEKLKGVTKNWEDVPGDQVKPDQYTEALAQRDKRIEELNQ
SLAAQEMLVEQLSREKQQLLHLLEEPTSMEVQPMTEELLKQQKLNSHETTITQQSVSDSH
LAELQEKIQQTEATNKILQEKLNEMSYELKCAQESSQKQDGTIQNLKETLKSRERETEEL
YQVIEGQNDTMAKLREMLHQSQLGQLHSSEGTSPAQQQVALLDLQSALFCSQLEIQKLQR
VVRQKERQLADAKQCVQFVEAAAHESEQQKEASWKHNQELRKALQQLQEELQNKSQQLRA
WEAEKYNEIRTQEQNIQHLNHSLSHKEQLLQEFRELLQYRDNSDKTLEANEMLLEKLHQR
IHDKAVALERAIDEKFSALEEKEKELRQLRLAVRERDHDLERLRGVLSSNEATMQSMESL
LRAKGLEVEQLSTTCQNLQWLKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEVEDLSAT
LLCKLGPGQSEIAEELCQRLQRKERMLQDLLSDRNKQVLEHEMEIQGLLQSVSTREQESQ
AAAEKLVQALMERNSELQALRQYLGGRDSLMSQAPISNQQAEVTPTGRLGKQTDQGSMQI
PSRDDSTSLTAKEDVSIPRSTLGDLDTVAGLEKELSNAKEELELMAKKERESQMELSALQ
SMMAVQEEELQVQAADMESLTRNIQIKEDLIKDLQMQLVDPEDIPAMERLTQEVLLLREK
VASVESQGQEISGNRRQQLLLMLEGLVDERSRLNEALQAERQLYSSLVKFHAHPESSERD
RTLQVELEGAQVLRSRLEEVLGRSLERLNRLETLAAIGGATAGDDTEDTSTEFTDSIEEE
AAHHSHQQLVKVALEKSLATVETQNPSFSPPSPMGGDSNRCLQEEMLHLRAEIHQRLEEK
RKAEEELKELKAQIEEAGFSSVSHIRNTMLSLCLENAELKEQMGEAMSDGWEIEEDKEKG
EVMVETVVTKEGLSESSLQAEFRKLQGKLKNAHNIINLLKEQLVLSSKEGNSKLTPELLV
HLTSTIERINTELVGSPGKHQHQEEGNVTVRPFPRPQSLDLGATFTVDAHQLDNQSQPRD
PGPQSTFSLPGSTQHLRSQLSQCKQRYQDLQEKLLLSEATVFAQANELEKYRVMLTGESL
VKQDSKQIQVDLQDLGYETCGRSENEAEREETTSPECEEHNSLKEMVLMEGLCSEQGRRG
STLASSSERKPLENQLGKQEEFRVYGKSENILVLRKDIKDLKAQLQNANKVIQNLKSRVR
SLSVTSDYSSSLERPRKLRAVGTLEGSSPHSVPDEDEGWLSDGTGAFYSPGLQAKKDLES
LIQRVSQLEAQLPKNGLEEKLAEELRSASWPGKYDSLIQDQARELSYLRQKIREGRGICY
LITQHAKDTVKSFEDLLRSNDIDYYLGQSFREQLAQGSQLTDRLTSKLSTKDHKSEKDQA
GLEPLALRLSRELQEKEKVIEVLQAKLDARSLTPSSSHALSDSHRSPSSTSFLSDELEAC
SDMDIVSEYTHYEEKKASPSHSDSIHHSSPSAVLSSKPSSTSASQGAKAESNSNPISLPT
PQNTPKEANQAHSGFHFHSIPKLASLPQAPLPSAPSSFLPFSPTGPPLLGCCETPVVSLA
EAQQELQMLQKQLGESASTVPPASTATLLSNDLEADPSYYLNSAQPHSPPRGTIELGRIL
EPGYLGSSGKWDVIRPQKGSVSGDLSSGSSVYQLNSKPTGADLLEEHLGEIRNLRQRLEE
SICINDRLREQLEHRLSSTARGRGSTSNFYSQGLESIPQLCSENRVLREENRRLQAQLSH
VSREHSQETESLREALLSSRSHLQELEKELEHQKVERQQLLEDLREKQQEVLHFREERLS
LQENDSRLQHKLVLLQQQCEEKQQLFESLQSELQIYEALYGNSKKGLKAYSLDACHQIPL
SSDLSHLVAEVRALRGQLEQSIQGNNCLRLQLQQQLESGAGKASLSPSSINQNFPASADP
GNKQLLLQDSAVSPPVRDVGMNSPALVFPSSASSTPGSETPIINRANGLGLDTSPVMKTP
PKLEGDATDGSFANKHGRHVIGHIDDYSALRQQIVEGKLLVKKIVSLVRSACSFPGLEAQ
GTEVLGSKGIHELRSSTSALHHALEESASLLTMFWRAALPSTHIPVLPGKVGESTERELL
ELRTKVSKQERLLQSTTEHLKTANQQKESMEQFIVSQLTRTHDVLKKARTNLEVKSLRAL
PCTPAL
Download sequence
Identical sequences ENSPTRP00000043516 ENSPTRP00000043516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]