SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043808 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043808
Domain Number 1 Region: 34-183
Classification Level Classification E-value
Superfamily L domain-like 2.15e-30
Family Ngr ectodomain-like 0.039
Further Details:      
 
Domain Number 2 Region: 571-631
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000114
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 666-715
Classification Level Classification E-value
Superfamily RING/U-box 0.00000275
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000043808
Domain Number - Region: 295-355
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.00706
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043808   Gene: ENSPTRG00000021390   Transcript: ENSPTRT00000048837
Sequence length 722
Comment pep:known_by_projection chromosome:CHIMP2.1.4:9:126590087:126642311:1 gene:ENSPTRG00000021390 transcript:ENSPTRT00000048837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVL
IVHTNHLTSLLPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLP
RSIGNLTQLQTLNVKDNKLKELPDTLGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSL
DASAMVYPPREVCGAGTAAILQFLCKESGLEYYPPSQYLLPVLEQDGTENSRDSPDGPTD
RFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQREHAQLLQQSSSQKDEILQTVK
EEQSRLEQGLSEHQRHLDAERQRLQEQLKQTEQNISSRIQKLLQDNQRQKKSSEILKSLE
NERIRMEQLMSITQEETENLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQAYSS
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRGQIKLIET
ELLQLTQLELKRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKS
ETRQENYWLIQYQRLLNQKPLSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLL
SQMSPGDLAKVGVSEAGLQHEILRRVQELLDAARIQPELKPPMGEVTPTAPQEPPESVRP
SAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCCQPLRTCPLCRQDIAQRLRIYH
SS
Download sequence
Identical sequences H2R2D9
ENSPTRP00000043808 9598.ENSPTRP00000043808 ENSPTRP00000043808 XP_001149463.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]