SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044022 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044022
Domain Number 1 Region: 585-693
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000288
Family SEA domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000044022
Domain Number - Region: 537-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 508-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00221
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044022   Gene: ENSPTRG00000019515   Transcript: ENSPTRT00000049393
Sequence length 756
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:101565564:101572354:1 gene:ENSPTRG00000019515 transcript:ENSPTRT00000049393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYSTVSSSTTAITSPFTTSETGVTSTPSSPSSLSTDIPTTSLRTLTPLPLCTSTSLTTTT
GLPSIPTDISSLPTPIHIISSSPSIQSTETSSLVGTISPTMSTVRATLRSTENTPMSSFS
TSIVVIPETPTQAPPVLMSATGTQTSPVPTTVTFGSMDSSTSTLLTLTPSTALSKIMSTS
QFPIPSTHSSTLQTTPSIPSLQTSLTSTSEFTTESFTRGSTSTNAILTSFSTIIWSSTPT
IIMSSSPSSASITPVFATTIHSVPSSPYIFSTENVGSTSITAFPSLSSSATTSTSPTSSS
LTTGLTETTPFSYISLPSTTPCPGTITITIVPASPTDPCVEMDPSTEATSPPTTPLTTFP
FTTEMVTCPSSISMQTTLATHMDTSSMTPESESSIIPNASSSIGTGTVPTNTVFTSTRLP
TSETWLSNSSVIPPPLPGISTIPLTMKPSSSLPTILRTSSKSTHPSPPTARTSETSVATT
QTPTTLTTRRTTPITSWMTTQYMLTTTAGTCDNGGTWKQGQCACLPGFSGDRCQLQTRCQ
NGGQWDSLKCQCPSTFYGSSCEFAVEQVDLDVVETEVGMEVSVDQQFSPDLNDNTSQAYR
DFNKTFWNQMQKIFADMQGFTFKGVEILSLRNGSIVVDYLVLLEMPFSPQLESQYEQVKT
TLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRAAPTGYEEFYFPL
VEATRLRCVTKCTSGVDNAIDCHQGQCVLETSGPAC
Download sequence
Identical sequences ENSPTRP00000044022 ENSPTRP00000044022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]