SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044097 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044097
Domain Number 1 Region: 37-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.44e-26
Family Laminin G-like module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044097   Gene: ENSPTRG00000013980   Transcript: ENSPTRT00000043235
Sequence length 669
Comment pep:known_by_projection chromosome:CHIMP2.1.4:21:30504083:30717982:-1 gene:ENSPTRG00000013980 transcript:ENSPTRT00000043235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLSLCFVLPLVAPGHGTQGWEPCTDLRPLDILEEVVPSDGATSGIRIVQVHGARGLQ
LSAAAPRTMSFPASRIFSRCDLFPEEFSIVVTLRVPSLPPKRNEYLLTVVAEESDLLLLG
LRLSPAQLHFLFLREDTAGAWQTRVSFRSPALVDGRWHTLVLAVSAGVFSLTTDCSLPVD
IMADVPFPATLSVKGARFFVGSRRRAKGLFTGLVRQLVLLPGSDATPRLCPSRNAPLAVL
SIPRVLQALTGKPEDNEVLKYPYETNIRVTLGPQPPCTEVEDAQFWFDASRKGLYLCVGN
EWVSVLAAKERLDYVEEHQNLSTNSETLGIEVFRIPQVGLFVATANRKATSAVYKWTEEK
FISYQNIPTHQAQAWRHFTIGKKIFLAVANFEPDEKGQEFSVIYKWSHRKLKFTPYQSIA
THSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWE
FFSVGPYSFLVVANTFNGTSTKVHSHLYIRLLGSFQLFQSFPTFGAADWEVFQIGERIFL
AVANSHSYDVEMQVQNDSYVINSVIYELNVTAQAFVKFQDILTCSALDWEFFSVGEDYFL
VVANSFDGRTFSVNSIIYRWQGYEGFVAVHSLPTVGCRDWEAFSTTAGAYLIYSSAKEPL
SRVLRLRTR
Download sequence
Identical sequences ENSPTRP00000044097 ENSPTRP00000044097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]