SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044121 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044121
Domain Number 1 Region: 296-458
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-48
Family SPRY domain 0.0000544
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000702
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 9-85
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000053
Family RING finger domain, C3HC4 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000044121
Domain Number - Region: 121-241
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000745
Family Apolipoprotein A-I 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044121   Gene: ENSPTRG00000017920   Transcript: ENSPTRT00000045204
Sequence length 465
Comment pep:known chromosome:CHIMP2.1.4:6:30539416:30548891:1 gene:ENSPTRG00000017920 transcript:ENSPTRT00000045204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATPSLKVVHELPACTLCAGPLEDAVTVPCGHTFCRLCLPALSQMGAQSSGKILLCPLC
QEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLD
EAIQPYRDRLRSRLEALSMERDEIEDVKCREDQKLQVLLTQIESKKHQVETAFERLQQEL
EQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRV
NQSRCEMKTFVSPEAISPDLVKKIRDFHRKILTLPEMMRMFSENLAHHLEIDSGVITLDP
QTASRSLVLSEDRKSVRYTRQKKNLPDSPLRFDGLPAVLGFPGFSSGRHRWQVDVQLGDG
GGCTVGVAGEGVRRKGEMGLSAEDGVWAVIISHQQCWASTSPGTDLPLSEIPRGVRVALD
YEAGQVTLHNAQTQEPIFTFTASFSGKVFPFFAVWKKGSYLTLKG
Download sequence
Identical sequences A0A2J8NX53 Q7YR33
ENSPTRP00000044121 ENSPTRP00000044121 9598.ENSPTRP00000044121 NP_001038973.1.37143 XP_003829795.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]