SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044124 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044124
Domain Number 1 Region: 1130-1223
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000628
Family Ypt/Rab-GAP domain of gyp1p 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000044124
Domain Number - Region: 4-53,174-285,457-560,937-1055
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family Armadillo repeat 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044124   Gene: ENSPTRG00000018559   Transcript: ENSPTRT00000049349
Sequence length 1257
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:122266239:122515666:-1 gene:ENSPTRG00000018559 transcript:ENSPTRT00000049349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHFSSEDQAMLQAMLRRLFQSVKEKITGAPSLECAEEILLHLEETDENFHNYEFVKYLR
QHIGNTLGSMIEEEMEKCTSDRNQGEECGYDTVVQQVTKRTQESKEYKEMMHYLKNIMIA
VVESMINKFEEDETRNQERQKKIQKEKSRSYCTDNCSDSDSSFNQSYKFCQGKLQLILDQ
LDPGQPKEVRYEALQTLCSAPPSDVLNCENWTTLCEKLTVSLSDPDPVFSDRILKFCAQT
FSLSPLHMTKEIYTSLAKYLESYFLSRENHIPTLSAGLDITNPNMTRLLKKVRLLNEYQK
EAPSFWIRHPEKYMEEIVESTLSLLTVKHNQSHVVSQKILDPIYFFALVDTKAVWFKKWM
HAHYSRTTVLRLLEKKYKSLVTTAIQQCVEYFELCKTRKADETLGHSKHCRNKQKTFYYL
GQELQYIYFLHSLCLLGRLLIYKQGRKLFPIKLKNKKGLVSLIDLLVLFTQLIYYSPSCP
KMTSAAHSENYSPASMVTEVLWILCDQKECAVECLYNNIVIETLLQPIHNLMKGNEASPN
CSETALIHIAGILARIASEEEGLILLLYGANMNSSEESPTGAHIIAQFSKKLLDEDISIF
SGSEMLPVVKGAFISVCRHIYSTCEGLQVLITYNLHESIAKAWKKTSLLSERIPTPVEGS
DSVSSVSQESQNIMAWEDNLLDDLLHFAATPKGLLLLQRTGAINECVTFIFNRYAKKLQV
SRHKKFGYGVLVTRVASTAAGGIALKKSGFINELITELWSNLEYGRDDVRVTHPRTTPVD
PIDRSCQKSFLALVNLLSYPAIYELVRNQDLPNKTEYSLREVPICVIDIIDRLIILNSEA
KIRSLFNYEQSHIFGLRDFIIDGLSVERNHVLVRINLVGGPLERILPPRILEKSDNPYPW
PMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKP
DIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNESLSSVQQLGIKMTVRYG
KFLNLLKDGAENDLTWVLKHCERFLKQQQTSIKSSLLCLQGNYAGHDWFVSSLFMIMLGD
KEKTFQFLRQFSRLLTSAFLWLPRLHISSYLPNDTVESGIHPVYFCSTHYIEMLLKAELP
LVFSAFHMSGFAPSQICLQWITQCFWNYLDWIEICHYIATCVFLGPDYQVYICIAVFKHL
QQDILQHTQTQDLQVFLKEEALHGFRVSDYFEYMEILEQNYRTVLLRDMRNIRLQST
Download sequence
Identical sequences A0A2J8PTT0
ENSPTRP00000044124 ENSPTRP00000044124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]