SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044519 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044519
Domain Number 1 Region: 265-329
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.19e-23
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 2 Region: 208-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000973
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 3 Region: 146-202
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000958
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 85-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000642
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 23-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000266
Family Complement control module/SCR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044519   Gene: ENSPTRG00000023151   Transcript: ENSPTRT00000048460
Sequence length 330
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL389138.1:14458:26908:1 gene:ENSPTRG00000023151 transcript:ENSPTRT00000048460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLMVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRL
QNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPSGERVRYQCRSPY
EMFGDEEVMCLNGYWTEPPQCKDSTGECGPPPPIDNGDITSFPLSVYAPASSVEYQCQNL
YELEGNKRITCRNGQWSEPPKCLHPCVISREIMEKCNIALRWTAKQKLYSRTGETVEFVC
KHGYRLSPSSHTLRTTCWDGKLEYPTCVKR
Download sequence
Identical sequences ENSPTRP00000044519 ENSPTRP00000044519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]