SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044630 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044630
Domain Number 1 Region: 814-988
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-41
Family MAM domain 0.00031
Further Details:      
 
Domain Number 2 Region: 510-610
Classification Level Classification E-value
Superfamily Immunoglobulin 4.79e-17
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 310-397
Classification Level Classification E-value
Superfamily Immunoglobulin 6.53e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 117-199
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000168
Family I set domains 0.04
Further Details:      
 
Domain Number 5 Region: 415-496
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000362
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 221-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000968
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 605-696
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000126
Family I set domains 0.034
Further Details:      
 
Domain Number 8 Region: 660-797
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000374
Family Fibronectin type III 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044630   Gene: ENSPTRG00000006311   Transcript: ENSPTRT00000045694
Sequence length 1025
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:45738829:46573901:-1 gene:ENSPTRG00000006311 transcript:ENSPTRT00000045694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVWSAGLLRSARGRRRGRTDGRRFLLRRAVPGHLGLARARVERAWLAAGLLKVPLRPPW
AGYVHVHVKMDLLYGLVWLLTVLLEGISGQGVYAPPTVRIVHSGLACNIEEERYSERVYT
IREGETLELTCLVTGHPRPQIRWTKTAGSASDRFQDSSVFNETLRITNIQRHQGGRYYCK
AENGLGSPAIKSIRVDVYYLDDPVVTVHQSIGEAKEQFYYERTVFLRCVANSNPPVRYSW
RRGQEVLLQGSDKGVEIYEPFFTQGETKILKLKNLRPQDYANYSCIASVRNVCNIPDKMV
SFRLSNKTASPSIKLLVDDPIVVNPGEAITLVCVTTGGEPAPSLTWVRSFGTLPEKTVLN
GGTLTIPAITSDDAGTYSCIANNNVGNPAKKSTNIIVRALKKGRFWITPDPYHKDDNIQI
GREVKISCQVEAVPSEELTFSWFKNGRPLRSSERMVITQTDPDVSPGTTNLDIIDLKFTD
FGTYTCVASLKGGGISDISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIELQCQVTGKP
KPIILWSRADKEVAMPDGSMQMESYDGTLRIVNVSREMSGMYRCQTSQYNGFNVKPREAL
VQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQ
EYTEYPVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVY
SYSLQWTQMNPDAVDRIVAYRLGIRQAGQQRWWEQEIKINGNIQKGELITYNLTELIKPE
AYEVRLTPLTKFGEGDSTIRVIKYSAPVNPHLREFHCGFEDGNICLFTQDDTDNFDWTKQ
STATRNTKYTPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSIAPKNPYGPT
NTAYCFSFFYHMYGQHIGVLNVYLRLKGQTTIENPLWSSSGNKGQRWNEAHVNIYPITSF
QLIFEGIRGPGIEGDIAIDDVSIAEGECAKQDLATKNSVDGAVGILVHIWLFPVIVLISI
LSPRR
Download sequence
Identical sequences H2R2Y5
ENSPTRP00000044630 ENSPTRP00000044630 XP_001151973.1.37143 XP_003831798.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]