SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044720 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044720
Domain Number 1 Region: 534-561,604-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.71e-16
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044720   Gene: ENSPTRG00000015818   Transcript: ENSPTRT00000043430
Sequence length 701
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:1015041:1020213:-1 gene:ENSPTRG00000015818 transcript:ENSPTRT00000043430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWRSCSCSVLCARALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLQPGANSSTLNGSAAMLDCGRDCYAIHV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRSAGQANVCDVVTSTVCLAVLLAAKELSDRYRHRLRVPLPTELLVIV
VATLVSHFGQLHERFGSSVAGDIPTGFMPPRVPEPRLMQRVALDAMALALVGAAFSISLA
EMFARSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLAGVILSLLSLAGRTQRPRTALLARIGDSAFYEDATEFEGLVPEPGVRVF
RFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSERGVGEGGPAQGEDLGPVSTRA
ALVPAAAGFHTVVIDCAPLLFLDAAGVSTLQDLRRDYGALGISLLLACCSPPVRDILSRG
GFLGEGPGDTAEEEQLFLSVHDAVQTARARHRELEATDAHL
Download sequence
Identical sequences H2R305
ENSPTRP00000044720 ENSPTRP00000044720 XP_003310259.1.37143 XP_016808187.1.37143 9598.ENSPTRP00000044720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]